PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g009653m
Common NameCISIN_1g009653mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SBP
Protein Properties Length: 530aa    MW: 59595.2 Da    PI: 8.5171
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g009653mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.47.3e-42203278277
                        -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                        Cqv gC++dls+ k+yh+rhkvC+vhsk+p+v+v+g eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk+q
  orange1.1g009653m 203 CQVYGCNKDLSSSKDYHKRHKVCDVHSKTPKVIVNGNEQRFCQQCSRFHLLAEFDDSKRSCRRRLAGHNERRRKPQ 278
                        **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.1E-33197264IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.727200277IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.23E-39201281IPR004333Transcription factor, SBP-box
PfamPF031108.0E-32203276IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MCHQMLSRHF HIAYFGQLRY CFKMESWIYG SEGKGILYSD EVDSSVDPFT RSRKTLMAWE  60
SKPSYNFDIN KLFSDSDDVE NMEFMDLCFT DLTRKPCHSN SSLGTPNGEV GSDTNERLTT  120
TPCMVTSNSF CGPESGSKIS SSCMKSISQD SALIDLKLGR LVDGRDKQCG KLFKERSVAS  180
SAHPSLMAKK VRTTSSCSQT PLCQVYGCNK DLSSSKDYHK RHKVCDVHSK TPKVIVNGNE  240
QRFCQQCSRF HLLAEFDDSK RSCRRRLAGH NERRRKPQFN IHSDRSRKLL QLYQGSELPW  300
TSLQNGTSFV YPDMLPGGIL FPERYEPVKQ IKFSERPPYS PQLAVPNTNE QLLTKSSLYQ  360
GNKKQHRLAI PLDTALTFQD SSGISHSSGA LSLLSAQSQS MPNHLSGIPM ARPLISQVSH  420
THLNLGQNFV KTSGTTPLGK YETKGFYTSG MNSMDGAQMR SLMVPDAGHA FELKVETDEV  480
SQESDFFKDK NCYSPEQGFT VDLIQLSSHL KRVEQQRNSI QPKQHTDDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-29194276284squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4634661e-43AM463466.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X160637.12, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015387350.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X2
TrEMBLA0A067FSF20.0A0A067FSF2_CITSI; Uncharacterized protein
STRINGPOPTR_0008s09750.11e-158(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14770918
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-52SBP family protein